PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009616658.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 319aa    MW: 36893.5 Da    PI: 6.8717
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009616658.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.15.8e-52141381128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lp+GfrFhPtd+elv++yL++k++g+++++ ++i+e+d+yk++Pw+Lp+k+ ++ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v + 
  XP_009616658.1  14 LPAGFRFHPTDDELVQHYLCRKCAGQPISV-SIIAEIDLYKFDPWQLPEKALHGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPVGK- 106
                     799***************************.89***************8888899*************************************98. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++ g+kk Lvfy g+ap+g kt+W+mheyrl
  XP_009616658.1 107 -PKTLGIKKALVFYAGKAPRGIKTNWIMHEYRL 138
                     .778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-619164IPR003441NAC domain
PROSITE profilePS5100559.56714164IPR003441NAC domain
PfamPF023653.9E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MIKGVLRNQQ QLELPAGFRF HPTDDELVQH YLCRKCAGQP ISVSIIAEID LYKFDPWQLP  60
EKALHGEKEW YFFSPRDRKY PNGSRPNRAA GTGYWKATGA DKPVGKPKTL GIKKALVFYA  120
GKAPRGIKTN WIMHEYRLAN VDRSAGKSNN LRLDDWVLCR IYNKKGTLEK YYNVDNKEHL  180
GFEEVEEEEE KPKILPFSQS NELIARLAPT PMPSRPQSMP GSDYFHFETS ESMTRMHTTN  240
SSSGSEYVLS SCDKEVQSAP KWDDLDKALD FQLNYLDNFQ YDPFEAQMQL QNCNTDQFNS  300
FQDMFVYMQK PYYSGANQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-85917010174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4131340.0HQ413134.1 Nicotiana tabacum NAC transcription factor (NAC) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616658.10.0PREDICTED: protein ATAF2-like
SwissprotQ390131e-116NAC2_ARATH; NAC domain-containing protein 2
TrEMBLE5LCI30.0E5LCI3_TOBAC; NAC transcription factor
STRINGSolyc04g009440.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-116NAC family protein